PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00006.202
Common NameAMTR_s00006p00257830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 434aa    MW: 46812.1 Da    PI: 9.4383
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00006.202genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC64.51.5e-20145185142
                                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                                               +aepgrCrRtDGKkWRC ++v++g+k+CE H++rgr rsrk+
  evm_27.model.AmTr_v1.0_scaffold00006.202 145 EAEPGRCRRTDGKKWRCPKEVVPGQKYCENHVNRGR-RSRKP 185
                                               58*********************************5.66665 PP

2QLQ38.73.1e-1477110235
                                       QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                                               ++T  Ql +L++Q+ +y++Laa++PvP+ Llq +
  evm_27.model.AmTr_v1.0_scaffold00006.202  77 PLTSLQLLELENQAFIYRCLAAGLPVPSTLLQSL 110
                                               78999**************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.7E-676112IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-977109IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.6877112IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166721.266145190IPR014977WRC domain
PfamPF088798.2E-18146185IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MTLEGSRKRR GESYVSRIGQ GTMKAPRMEL FSCFTPMALY QNPQFYYPLA TNATGPGLGG  60
ERSNGNFNGV SGGSRDPLTS LQLLELENQA FIYRCLAAGL PVPSTLLQSL SDLNLLGGSL  120
STVGGGSLFT FGGGQVRSGY AGNREAEPGR CRRTDGKKWR CPKEVVPGQK YCENHVNRGR  180
RSRKPVGTQA RQAASSRASS TTSRRFQVRR NSPSQAFFSR PSVQPNIGRG MFRFPQRDLL  240
SVPSVNFGFN PNSPAMELPS PTFNLGYNTM PGILFNDQRA ASFQSRNLTP NLNMMPNLLD  300
LAPSAPMQAP TLSNSMDDYF SLSSFFTGLS LYPPSVSSGS NTDQTEITVS NGYTDQTSSS  360
NDQANWFLTD SIGGGGPLGE MLNSSFGWRS YTPGESSTMN LMNENSESVS SPTAVILTNI  420
DSEAYSSNGS SQT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1PDM50.0W1PDM5_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-22growth-regulating factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]